PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678404446
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NF-YB
Protein Properties Length: 176aa    MW: 19363.5 Da    PI: 4.6527
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678404446genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB176.92e-5523118297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                reqd+flPianvsrimkk+lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa+atlGfe+y++pl+ yl+++r++egek
  678404446  23 REQDKFLPIANVSRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMATLGFENYMAPLRFYLQRFRDTEGEK 118
                89*******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.3E-5118127IPR009072Histone-fold
SuperFamilySSF471132.17E-3825131IPR009072Histone-fold
PfamPF008081.1E-272892IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-185674No hitNo description
PROSITE patternPS0068505975IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.5E-187593No hitNo description
PRINTSPR006151.5E-1894112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MLDSDGSGGI HRDTNYHSES SPREQDKFLP IANVSRIMKK ALPANAKISK EAKETVQECV  60
SEFISFITGE ASDKCQREKR KTINGDDLLW AMATLGFENY MAPLRFYLQR FRDTEGEKNA  120
TLSRGDKDSV GGYSAWVGGD AAAGGYETGM GGSFFGDTVS ESDFWSFPWP DMGGPM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A9e-4521113193NF-YB
4awl_B9e-4521113294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A9e-4521113294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095535.17e-69PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233107e-65NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A068UZA67e-69A0A068UZA6_COFCA; Uncharacterized protein
STRINGVIT_19s0015g00440.t012e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.14e-66nuclear factor Y, subunit B3